PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast05G015400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 210aa    MW: 23812.9 Da    PI: 9.8375
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast05G015400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.42.8e-0731621748
                        HHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding 17 kqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                        +++Gg+   ++I r+++ gR++kqc++rw ++l
  Brast05G015400.1.p 31 NRYGGErKCAAITRHLP-GRSGKQCRERWMNHL 62
                        45555578899******.*************97 PP

2Myb_DNA-binding36.79.4e-1271113347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +W +e+d+ l++++ ++G++ W+ Iar +   R++k++ ++w+ +
  Brast05G015400.1.p  71 PWFEEDDKALIQGHMRFGNR-WSEIARDLL-ERSEKDVNNHWNHF 113
                         799*****************.********9.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.072166IPR017930Myb domain
SMARTSM007170.0011764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-141069IPR009057Homeodomain-like
CDDcd001673.90E-61162No hitNo description
PfamPF002491.2E-54062IPR001005SANT/Myb domain
SuperFamilySSF466893.4E-2142116IPR009057Homeodomain-like
PROSITE profilePS512949.06567118IPR017930Myb domain
SMARTSM007172.6E-868116IPR001005SANT/Myb domain
CDDcd001678.46E-871111No hitNo description
Gene3DG3DSA:1.10.10.601.7E-1271112IPR009057Homeodomain-like
PfamPF002495.2E-1071111IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MDQAPVLKGG WTREEDSCVT RLNQISREMM NRYGGERKCA AITRHLPGRS GKQCRERWMN  60
HLRSELKKDA PWFEEDDKAL IQGHMRFGNR WSEIARDLLE RSEKDVNNHW NHFYGMPYRF  120
FVALAGDLWD KRRRDELEME GGISGKSGGG TETAGFVVNA VRRSLGSKRQ LKKKKSEQAP  180
PGQFTALEQY IGSPGNPNSA VPLALAGYD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C5e-276111298C-Myb DNA-Binding Domain
1mse_C5e-276111298C-Myb DNA-Binding Domain
1gv2_A6e-276111298MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0Q3GHR85e-49A0A0Q3GHR8_BRADI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.18e-29myb domain protein 119